Preview

DNA Sequence Analysis

Satisfactory Essays
Open Document
Open Document
280 Words
Grammar
Grammar
Plagiarism
Plagiarism
Writing
Writing
Score
Score
DNA Sequence Analysis
1.)

The only difference between the wild type and mutant sequence is a point mutation at gene 1755, where a guanine is replaced with an adenine.

2.)
a.)
Wild Type Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS
SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI
SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF
VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE
NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS
AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP
LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ
PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH
QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHNWDDFGNNVPLDDDEEG
SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL
RTPSPSDPNLV-

Mutant Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS
SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI
SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF
VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE
NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP
NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS
AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP
LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ
PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH
QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHN-DDFGNNVPLDDDEEG
SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL
RTPSPSDPNLV-

b.)
The point mutation in translation caused a guanine to be changed to an adenine. In transcription, this caused a W at amino acid 585 to be changed into a stop codon, thus making transcription prematurely end in the mutant sequence.
3.)
a.) The most highly conserved regions across the proteins occur at amino acids 81-195 and 211-275.
b.) It is predicted that the DNA
Continue Reading
View Writing Issues

You May Also Find These Documents Helpful

  • Satisfactory Essays

    Hsc2 Unit 1 Assignment
    • 402 Words
    • 2 Pages

    Hsc2 Unit 1 Assignment

    i) The enzyme that would be used to cut the vector would be SalI along with adding the CIP. The main reason that you would cut with the particular enzyme Sal I is because the beginning of the vector sequence there isn’t a stop codon, so but cutting it with Sal I than both the vector and the protein will be compatible. There however is going to be a function of the CIP. CIP is a very important aspect of the whole process because once the vector is opened; the CIP is going to…

    • 402 Words
    • 2 Pages
    Satisfactory Essays
    Read More
  • Good Essays

    Sci206 Unit 3 Individual Project
    • 565 Words
    • 3 Pages

    Sci206 Unit 3 Individual Project

    In mutation, the information in the DNA base sequence is changed, thus leading to a mistake in DNA replication. 2 examples of mutations and the chance in the amino acid sequence are as follows:…

    • 565 Words
    • 3 Pages
    Good Essays
    Read More
  • Good Essays

    Btec Level 3 Unit 25 D2
    • 1411 Words
    • 6 Pages

    Btec Level 3 Unit 25 D2

    In this case, only one DNA triplet may be altered and so a frameshift does not occur. This substitution may result in a nonsense, mis-sense or silent mutation. A nonsense mutation will occur if the substitution results in the formation of one out of three of the stop codons. This will cause the synthesis of the polypeptide to be stopped prematurely and therefore the final protein will be very different from the protein that was originally intended to be synthesised. This new polypeptide will be shorter and is unlikely to function. An example of this is the non functional protein that causes albinism; a disease that means the organism cannot produce melanin, a characteristic selected against in animals due to highlighting the organism to predators. A mis-sense mutation is when a DNA base change results in a new mRNA codon that codes for a different amino acid. The new polypeptide chain will have one amino acid different to the normal form, which may not have a serious effect on the polypeptide but as the primary sequence of the amino acid is important in determining the tertiary and quaternary 3D structure of the protein, the shape of the protein may change. This is particularly important in enzymes, where the protein may not function normally as the active site shape may no longer be complementary to the substrate. An example of a mis-sense mutation can be seen in sickle cell anaemia. Sickle Cell Anaemia is an example of co-dominance as both alleles are expressed in the phenotype of heterozygote. A substitution of the T in base CTC causes the new codon to become CAC. This one amino acid is changed on the beta globulin chain of haemoglobin causing glutanic acid to become valine acid. This causes abnormal haemoglobin molecules to be produced, producing red blood cells that are sickle shaped. These red blood cells cannot carry as much oxygen to cells for respiration, resulting in less ATP being…

    • 1411 Words
    • 6 Pages
    Good Essays
    Read More
  • Good Essays

    Dna Sci/230
    • 494 Words
    • 2 Pages

    Dna Sci/230

    DNA stands for Deoxyribonucleic acid and looks like a spiral. The spiral is also known as a double helix. The strands are made up of our genetic information, composed of genes and chromosomes. There are four bases divided among purines and pyrimidines. On the purines there are Adenine (A) and Guanine (G). On the pyrimidines there are Cytosine (C) and Thymine (T). The base pairs are Adenine and Thymine (A-T) and Cytosine and Guanine (C-G). DNA is found in the nucleus of every human cell. Humans have 46 chromosomes. When a cell reproduces, the chromosomes get copied and distributed to each offspring.…

    • 494 Words
    • 2 Pages
    Good Essays
    Read More
  • Satisfactory Essays

    DAT Study Guide
    • 734 Words
    • 3 Pages

    DAT Study Guide

    Chapter 8 ASSIGNMENT - Evolution
1. The amino acid sequence for the globins (alpha, beta, delta, epsilon, gammaA, gammaG) are aligned below. The red letters in
the beta and delta sequences show the locations of replacement.…

    • 734 Words
    • 3 Pages
    Satisfactory Essays
    Read More
  • Satisfactory Essays

    Ls1180 Unit 1 Biology Key
    • 448 Words
    • 2 Pages

    Ls1180 Unit 1 Biology Key

    This paper contains THIRTY-EIGHT questions in FIVE sections: Sections A, B, C, D and E. Answer THIRTY-FOUR questions only…

    • 448 Words
    • 2 Pages
    Satisfactory Essays
    Read More
  • Good Essays

    Conclusion 3211 Describe How The DNA
    • 518 Words
    • 2 Pages

    Conclusion 3211 Describe How The DNA

    7 Note the two transcribed and translated DNA strips below. The two strips are identical except for a point mutation, where the 15th base was changed from a G to a T. Fill in the corresponding mRNA, tRNA, and letter in the blanks below for the mutated DNA strip. In the space below, explain how this point mutation changes the protein.…

    • 518 Words
    • 2 Pages
    Good Essays
    Read More
  • Satisfactory Essays

    Sci 230 Dna
    • 490 Words
    • 2 Pages

    Sci 230 Dna

    DNA is composed of two polynucleotide strands wound together into a structure known as a double helix. Each nucleotide consists of a sugar base .Nucleotides form together creating a sugar phosphate backbone to each strand. There are three forms of DNA that differ significantly. The most common, B form, is the structure most people have heard of. It consists of the right handed double helix, with a large major groove and a smaller but accessible minor groove. These grooves are spaces between the backbones which allow access to the bases for interactions with proteins. A form DNA is also a right handed helix, but as yet has not been found in organisms, and only exists in synthetic environments. It has a wider, flatter structure. Z form DNA is found in living organisms, but is a left handed helix, meaning it twists in the opposite direction.…

    • 490 Words
    • 2 Pages
    Satisfactory Essays
    Read More
  • Good Essays

    Lab 8: Genetic Analysis
    • 297 Words
    • 2 Pages

    Lab 8: Genetic Analysis

    In Lab 8, we had analyzed remains found at a wooded area near Jonesburg and tried to determine if the bones belonged to a 28-year-old woman who had been reported missing from a city within the vicinity. Upon analysis, it was determined that they did belong to a female. However, it was not possible to determine if the bones did belong to the missing women. Lab 12 presented the opportunity to genetically analyze the remains found. DNA profiling, also referred to as typing and fingerprinting, uses genetic material to show relatedness and uncover the identity of organisms. Most commonly associated with forensics, it can be used in an array of scientific fields such as anthropology. One method that can be used, when a large sample present, is restriction…

    • 297 Words
    • 2 Pages
    Good Essays
    Read More
  • Satisfactory Essays

    Exam 1 Review
    • 1693 Words
    • 7 Pages

    Exam 1 Review

    If a tRNA had an AGC anticodon, it could attach to a(n) ________ mRNA codon.…

    • 1693 Words
    • 7 Pages
    Satisfactory Essays
    Read More
  • Satisfactory Essays

    Dna Work Sheet
    • 491 Words
    • 2 Pages

    Dna Work Sheet

    Describe the structure of DNA.DNA is thread formed by two strands, related together to form a double helix. The double helix looks like a twisted ladder. The sides of this ladder are long unites called nucleotides and are made of three parts; a nitrogenous base, a sugar, and a phosphate group. The sides of the ladder or the nucleotides from the two separate strands of the DNA are attached by an appendage made of one of four separate bases. These appendages represent the rungs of the DNA ladder and are attached to the complimentary strand of the DNA. The bases or rungs are made of either Adenine (A) OR Thymine (T) or Cytosine (C) and Guanine (G). The attachment of the strands by the bases is specific Adenine can only join with Thymine, and Cytosine can only join with Guanine. Since this base pairing is specific, if one knows the sequence of bases a long one strand of the DNA one will also know the strand of the DNA one will also know the sequence along the complimentary strand.…

    • 491 Words
    • 2 Pages
    Satisfactory Essays
    Read More
  • Good Essays

    Dna Worksheet
    • 459 Words
    • 2 Pages

    Dna Worksheet

    DNA is a structure of specific molecules and a complex mixture of chemicals. DNA is a nucleic acid, which is a group of complex compounds that can be found in all living cells or viruses, and controls cell health and function. Nucleic acids are composed of polymers and monomers, which are referred to as nucleotides. There are four different types of nucleotides that make up the structure of DNA, which are abbreviated A, C, T, and G. Covalent bonds join together nucleotides through sugar and phosphate. Polynucleotides, or a polymer nucleotide, which tends to be longer than a monomer nucleotide, contains many variations of arrangements of A, C, T, and G.…

    • 459 Words
    • 2 Pages
    Good Essays
    Read More
  • Satisfactory Essays

    Protein and Mutated Gene Sequence
    • 438 Words
    • 2 Pages

    Protein and Mutated Gene Sequence

    3’-T A A C C T T T A C T A G G C A C T-5’…

    • 438 Words
    • 2 Pages
    Satisfactory Essays
    Read More
  • Good Essays

    Thematic DNA Analysis: Forensic
    • 373 Words
    • 2 Pages

    Thematic DNA Analysis: Forensic

    Forensic serve both the living and the dead -- those who are victims, suspects, survivors, and those who are left behind. Forensic nursing blends nursing science with medicine, law, and criminology. At its core, this specialty seeks to address healthcare issues that have a medico legal component. Long before holding the designation of forensic nurse, nurses provided care to the victims and perpetrators of violence. History reveals that in the 14th century, performed gynecologic examinations for evidence of pregnancy or virtue, and then testified before the King's court. Forensic nurses do not replace other forensic professionals, but instead bring a unique nursing perspective to the multidisciplinary forensic team.…

    • 373 Words
    • 2 Pages
    Good Essays
    Read More
  • Good Essays

    DNA Work Sheet
    • 506 Words
    • 3 Pages

    DNA Work Sheet

    Describe each stage of the flow of information starting with DNA and ending with a trait.…

    • 506 Words
    • 3 Pages
    Good Essays
    Read More

Related Topics