Protein Biochemistry

Only available on StudyMode
  • Topic: Protein, Secondary structure, Alpha helix
  • Pages : 4 (614 words )
  • Download(s) : 35
  • Published : March 8, 2013
Open Document
Text Preview
Lab 2: Internet Resources for Protein Biochemistry

Part 1-1:
A)
Protein Accession Number = P00939

Name of Protein:
 Full Name = Triosephosphate isomerase; Short Name=TIM

Organism where the protein is found:
Oryctolagus cuniculus = Rabbit

Nuber of amino acids in the protein:
AA = 248

B)
* Amino Acid Sequence:

>gi|136066|sp|P00939.1|TPIS_RABIT RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: Full=Triose-phosphate isomerase
APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

C)
Description:
This protein plays a significant role in the energy production of glycolysis and is found in practically every organism that acquires energy in this manner. This enzyme is essential to catalyze the conversion reaction between dihydroxyacetone phosphate and D-glyceraldehyde 3-phosphate.

Part 1-2:

The first human ortholog on the list derived from the BLAST of our Rabbit protein is called: Chain A, Human Triosephosphate Isomerase Of New Crystal Form. Its ID# is 1WYI_A . It is 98% identical to our Rabbit TIM.

* This human protein has the 250 amino acids with the following sequence:

>gi|66360365|pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form
GSAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYK
VTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGI
TEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

Part 1-3:

Alignment of Rabbit TIM (top) and...
tracking img