Protein Biochemistry

Topics: Protein, Secondary structure, Alpha helix Pages: 4 (614 words) Published: March 8, 2013
Lab 2: Internet Resources for Protein Biochemistry

Part 1-1:
A)
Protein Accession Number = P00939

Name of Protein:
 Full Name = Triosephosphate isomerase; Short Name=TIM

Organism where the protein is found:
Oryctolagus cuniculus = Rabbit

Nuber of amino acids in the protein:
AA = 248

B)
* Amino Acid Sequence:

>gi|136066|sp|P00939.1|TPIS_RABIT RecName: Full=Triosephosphate isomerase; Short=TIM; AltName: Full=Triose-phosphate isomerase
APSRKFFVGGNWKMNGRKKNLGELITTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALSEGLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

C)
Description:
This protein plays a significant role in the energy production of glycolysis and is found in practically every organism that acquires energy in this manner. This enzyme is essential to catalyze the conversion reaction between dihydroxyacetone phosphate and D-glyceraldehyde 3-phosphate.

Part 1-2:

The first human ortholog on the list derived from the BLAST of our Rabbit protein is called: Chain A, Human Triosephosphate Isomerase Of New Crystal Form. Its ID# is 1WYI_A . It is 98% identical to our Rabbit TIM.

* This human protein has the 250 amino acids with the following sequence:

>gi|66360365|pdb|1WYI|A Chain A, Human Triosephosphate Isomerase Of New Crystal Form
GSAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYK
VTNGAFTGEISPGMIKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGI
TEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ

Part 1-3:

Alignment of Rabbit TIM (top) and...
Continue Reading

Please join StudyMode to read the full document

You May Also Find These Documents Helpful

  • Protein Paper
  • Task 2 Biochemistry Essay
  • A Short History of Biochemistry Essay
  • Protein Structure and Function Essay
  • protein structure Essay
  • The structure of proteins Essay
  • Introduction to Biochemistry Essay
  • Isolation and Characterization of Proteins Essay

Become a StudyMode Member

Sign Up - It's Free