Products

About

©2018 StudyMode.com

DNA Sequence Analysis

Topics: Gene, DNA, Amino acid Pages: 2 (280 words) Published: October 9, 2012
1.)

The only difference between the wild type and mutant sequence is a point mutation at gene 1755, where a guanine is replaced with an adenine.

2.)
a.)
Wild Type Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHNWDDFGNNVPLDDDEEG SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL RTPSPSDPNLV-

Mutant Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHN-DDFGNNVPLDDDEEG SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL RTPSPSDPNLV-

b.)
The point mutation in translation caused a guanine to be changed to an adenine. In transcription, this caused a W at amino acid 585 to be changed into a stop codon, thus making transcription prematurely end in the mutant sequence. 3.)

a.) The most highly conserved regions across the proteins occur at amino acids 81-195 and 211-275. b.) It is predicted that the DNA binding domain of HSF-1...
Continue Reading

Please join StudyMode to read the full document

You May Also Find These Documents Helpful

  • Dna Essay

    ...DNA DNA, or Deoxyribonucleic Acid, is described, in Encarta Encyclopedia as a genetic material of all cellular organisms and most viruses. DNA carries the information needed to direct protein synthesis and replication. Protein synthesis is the production of the proteins needed by the cell or virus for its activities and development. Replication is the process by which DNA copies itself for each descendant cell or virus, passing on the information needed for protein synthesis. In most cellular organisms, DNA is organized on chromosomes located in the nucleus of the cell. A molecule of DNA consists of two chains, strands composed of a large number of nucleotides, that are linked together to form a chain. These chains look like a twisted ladder and are called a double helix. Each nucleotide consists of three units: sugar molecules called deoxyribose, a phosphate group, and one of four different nitrogen containing compounds, also called bases. The four are adenine (A), guanine (G), thymine (T), and cytosine (C). The deoxyribose molecule occupies the center of the nucleotide, with the phosphate group on one side and a base on the other. The phosphate group of each nucleotide is also linked to the deoxyribose of the adjacent nucleotide in the chain. These linked deoxyribose-phosphate subunits form the side rails of the ladder. The bases face inward toward each other, forming the steps of...

    Read More
    998 Words 3 Pages
  • Comparing Dna Sequences to Understand Evolutionary Relationships with Blast Essay

    ...Name: Rimsha Ahmed John F Kennedy HS Dr. Fisher Date: 1-14-13 Block: 3 I. Comparing DNA Sequences to Understand Evolutionary Relationships with BLAST: III. INTRODUCTION: NULL HYPOTHEISIS: Mental disorders are not present in animals. HYPOTHESIS: As much as life has evolved, the relationship between animals and humans has remained very close to each other. If animals are, evolutionally, and genetically similar to humans; can they develop the same diseases we have today? Humans today have mental disorders left and right: OCD(obsessive compulsive disorder), autism, ADD (attention deficient disorder), bipolar disorder, depression, insomnia, anxiety. If all these diseases occur in the minds of humans, can they occur in the minds of animals also? Dogs share approximately 75% of their DNA with humans; can it occur in them too? A lacking in the protein called SAPAP3 is believed to be the cause of OCD-related symptoms in mice. If the protein SAPAP3 is found in other organisms, can they be susceptible to mental disorders similar to OCD? If the protein named SAPAP3 is found in dogs, coyotes, wolves, foxes (taxid:9608) at more than 75% identical, then these animals are vulnerable to mental disorders similar to OCD. VI. RESULTS: QUANTITATIVE: These are our top 5 results. The first one is nearly identical to the gene, while the bottom four are barely half similar. The most similar protein was found in Canis...

    Read More
    1682 Words 5 Pages
  • Sequence Analysis of the Third Man Essay

    ...10/7/12 The Third Man Sequence Analysis In Carol Reed’s The Third Man, the sequence in which the police and their bait, Holly, anxiously wait for the arrival of their target, Harry, is full of suspense and displayed through over 25 shots in less than 3 minutes. The sequence captures the anxiousness and suspense experienced by all the characters through its quick cuts of empty streets, destroyed buildings, and dark shadows. The score of this sequence heavily influences the mood and different thematic elements of the scene. Through this nearly silent (almost no dialogue) segment, Reed brings the viewers into the scene through the perspectives of different characters surveying the empty, quiet and dark city of Vienna for the man they are trying to capture, Harry Lime. The first shot of this sequence is a fade-in of the café in which Holly is settling down while waiting for Harry. The signature zither music picks up again to indicate the suspense of patiently waiting to complete a set-up that will allow the police to arrest a criminal. It then cuts to inside the café where Holly anxiously sits and begins to look outside the window examining the ominous, empty streets of Vienna. This shot is a prime example of the unique askew camera placement used throughout the entire film. In this shot, like several others, the frame is angled quite awkwardly. This technique embodies the creation of a...

    Read More
    1496 Words 4 Pages
  • French Connection Sequence Analysis Essay

    ...FRENCH CONNECTION SEQUENCE ANALYSIS For this sequence analysis, I have chosen a scene from William Friedkin’s The French Connection. The scene chosen is the chase sequence and confrontation between Popeye Doyle and the sniper on the roof who worked for “Frog number one”. I believe that this sequence differs from classical Hollywood conventions in a numbers of important ways, marking it quite clearly as a different sort of film to the police procedurals which may have come before it. The sequence begins with Popeye Doyle walking back to his apartment, whereupon a sniper kills a young mother with a bullet intended for Doyle. Despite this being an innocent woman caught in the cross-fire, Doyle shows little concern overall and we do not later learn her fate, unlike a classic Hollywood film where some sadness or remorse would be shown by Doyle over the death of this innocent person. This foreshadows his later complete disregard for killing of the FBI agent at the conclusion of the film, showing Doyle to perhaps be without the morals, honor and integrity we would normally assume of our Hollywood cop “heroes”. Doyle chases the sniper, losing him at a train station and commandeering a car to follow the train to its next stop. The chase is shown from inside the car, angles behind and in front of the car and in wide-angle shots. Interspersed with this, we see the sniper...

    Read More
    858 Words 3 Pages
  • Sequence Analysis of the Searchers Essay

    ...Sequence Analysis on The Searchers The Searchers is a film about a man and his adopted nephew’s search for their niece and sister, respectively, after they had been lured away by a trap set by Comanche Indians. While lured away searching for the missing cattle, the Comanche sneaked in behind them and razed Ethan’s brother’s house. They killed their family including Ethan’s brother, his brother’s wife Martha, whom it had been presented earlier that Ethan clearly loved through certain shots such as them sharing a long, passionate hug, and their son Ben. They also kidnapped Ethan’s nieces Lucy and Debbie. This series of events is what leads up to the pursuance of Debbie and mainly the Comanche who stole her away. It is evident throughout the early stages of the film, before this clip, that Ethan had a disdain for Indians, such as when he labels Martin a half-breed with a contemptuous tone of voice. Ethan already felt a deep seated hatred for the Comanche and this kidnapping of his nieces and massacre of his beloved was like throwing gasoline onto an already raging inferno. He becomes a man stricken with a feverish obsession to exact revenge against the Comanche and free his niece from the clutches of these savages. In this clip of The Searchers, John Ford uses techniques of mise-en-scene, cinematography, and editing to convey moods of revenge and contempt as well as to contrast Martin and Ethan’s reasons for searching for their sister...

    Read More
    1119 Words 3 Pages
  • The Rear Window

    ...Sequence Analysis 1 – The Rear Window Although many realist films tend to realize that the viewer is an observer, there is a theme that is clearly established in the first few minutes of Rear Window (Alfred Hitchcock, 1954) with a variety of long shots that clearly show the setting; complimenting this Hitchcock also utilizes pan and dolly as well as transitioning angles so we can observe every apartment and tenant. Sound and different camera distance also contributes to the mise en scene that further presents the theme in conjunction with the cinematography. The mise en scène and cinematography in the beginning sequence of Rear Window clearly sets the stage for the viewer to take on a role of careful yet clear observation and watchfulness. This in turn sets the overall theme of rubbernecking or spying, not just observing. To start out, we are placed behind the confinement of an apartment looking at three open windows with the shades down. As they slowly open, we begin to observe the first cinematographic technique Hitchcock uses to introduce the theme of observing. We dolly out of the window to see that we are on a top floor of an apartment in an apartment block. Because we are out of the window, we begin to crane. It reinforces the fact that we are actually looking out over the apartment block, observing everything we see. This is emphasized further as we immediately transition to a high angle shot. This places us in a position...

    Read More
    865 Words 3 Pages
  • The Wrestler Sequence Analysis Essay

    ...I am going to give a detailed analysis of a sequence from The Wrestler (2008) directed by Darren Aronofsky. The source I have decided to use for this analysis is the screenplay of the film, rather than a downloaded version of the script. The sequence I have chosen begins at 32min of the film and continues until 41:09 min. I chose this sequence because it is the most important sequence in the film, as it has a major influence on the events of the script that follow, and according to Syd Field’s Three Act Structure, it is located at Plot Point 1. Often called a reversal, a plot point is an event that advances the plot in a new direction, and leading to the next act of the screenplay. Other screenplay experts, who agree with Field’s theories, have stated that Plot Point 1 is the moment when the hero takes on the problem. It is the true beginning of the story. At the beginning of the sequence, the character of Randy “The Ram Robinson”, the film’s protagonist, has just been treated by doctors after a brutal wrestling match, and has been left alone in his dressing him. He proceeds to walk over to his locker, but before he reaches it, his stares intensely at his left arm while clutching his chest, vomits twice and collapses on the floor. Randy has suffered a heart attack, and it is this event that thrusts the plot in a new direction, cementing this sequence as Plot...

    Read More
    1915 Words 5 Pages
  • Sequence Analysis Wizard of Oz Essay

    ...Sequence Analysis: Wizard of Oz Rabi Kumaraswamy October 31, 2014 DRAMA 3030 Dr. Aaron Taylor In the Wizard of Oz, we see the journey of a girl, Dorothy Gale, in her dreams to escape her dismal life on the farm and her troubles with her aunt and uncle. It is only after she dreams of being in a place unfamiliar and troublesome that she realizes how much her family means to her. From this we can see the film’s explicit meaning: “There’s no place like home.” Although this line can in ordinary be a cliché, it relates back to Dorothy’s desires and ordeals toward her goal of returning home from Oz. The general idea we take away from this film is that maturation of not only Dorothy but her colleagues, play a role in understanding that being able to acknowledge our past and learn from it, can help to push through to discover one’s already perceived potential. This can be seen in another explicit meaning: “Somewhere over the rainbow,” which when joined with, “There’s no place like home,” creates a combined overall purpose. To explain, this means that, ‘somewhere over the rainbow,’ may look adventurous and possibly hold a new future, but remembering what has been done in the past to get you there will only enlarge the past memories or capabilities gained from ‘home’ or the beginning. The directors do a marvelous job of representing them throughout the film, not only through narrative but also through the film’s mise-en-scene. We can see some of these...

    Read More
    1026 Words 4 Pages

Popular Essays

Become a StudyMode Member

Sign Up - It's Free