DNA Sequence Analysis

Topics: Gene, DNA, Amino acid Pages: 2 (280 words) Published: October 9, 2012
1.)

The only difference between the wild type and mutant sequence is a point mutation at gene 1755, where a guanine is replaced with an adenine.

2.)
a.)
Wild Type Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHNWDDFGNNVPLDDDEEG SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL RTPSPSDPNLV-

Mutant Protein Transcription:
MQPTGNQIQQNQQQQQQLIMRVPKQEVSVSGAARRYVQQAPPNRPPRQNHQNGAIGGKKS SVTIQEVPNNAYLETLNKSGNNKVDDDKLPVFLIKLWNIVEDPNLQSIVHWDDSGASFHI SDPYLFGRNVLPHFFKHNNMNSMVRQLNMYGFRKMTPLSQGGLTRTESDQDHLEFSHPCF VQGRPELLSQIKRKQSARTVEDKQVNEQTQQNLEVVMAEMRAMREKAKNMEDKMNKLTKE NRDMWTQMGSMRQQHARQQQYFKKLLHFLVSVMQPGLSKRVAKRGVLEIDFCAANGTAGP NSKRARMNSEEGPYKDVCDLLESLQRETQEPFSRRFTNNEGPLISEVTDEFGNSPVGRGS AQDLFGDTFGAQSSRYSDGGATSSREQSPHPIISQPQSNSAGAHGANEQKPDDMYMGSGP LTHENIHRGISALKRDYQGASPASGGPSTSSSAPSGAGAGARMAQKRAAPYKNATRQMAQ PQQDYSGGFVNNYSGFMPSDPSMIPYQPSHQYLQPHQKLMAIEDQHHPTTSTSSTNADPH QNLYSPTLGLSPSFDRQLSQELQEYFTGTDTSLESFRDLVSNHN-DDFGNNVPLDDDEEG SEDPLRQLALENAPETSNYDGAEDLLFDNEQQYPENGFDVPDPNYLPLADEEIFPHSPAL RTPSPSDPNLV-

b.)
The point mutation in translation caused a guanine to be changed to an adenine. In transcription, this caused a W at amino acid 585 to be changed into a stop codon, thus making transcription prematurely end in the mutant sequence. 3.)

a.) The most highly conserved regions across the proteins occur at amino acids 81-195 and 211-275. b.) It is predicted that the DNA binding domain of HSF-1...
Continue Reading

Please join StudyMode to read the full document

You May Also Find These Documents Helpful

  • Dna Essay
  • Comparing Dna Sequences to Understand Evolutionary Relationships with Blast Essay
  • Sequence Analysis of the Third Man Essay
  • French Connection Sequence Analysis Essay
  • Sequence Analysis of the Searchers Essay
  • The Rear Window
  • The Wrestler Sequence Analysis Essay
  • Sequence Analysis Wizard of Oz Essay

Become a StudyMode Member

Sign Up - It's Free